Allermatch statistics

info info

Citations per year

Number of citations per year for the bioinformatics software tool Allermatch
info

Tool usage distribution map

This map represents all the scientific publications referring to Allermatch per scientific context
info info

Associated diseases

info

Popular tool citations

chevron_left Allergen prediction chevron_right
Want to access the full stats & trends on this tool?

Allermatch specifications

Information


Unique identifier OMICS_12396
Name Allermatch
Interface Web user interface
Restrictions to use None
Computer skills Basic
Stability Stable
Maintained No

Maintainer


This tool is not maintained anymore.

Publication for Allermatch

Allermatch citations

 (7)
library_books

Genetically engineered bananas resistant to Xanthomonas wilt disease and nematodes

2017
PMCID: 5488630
PMID: 28713567
DOI: 10.1002/fes3.101

[…] abases. The peptide expressed in plantains is destroyed by cooking and by simulated intestinal fluid. It is not recognized as a potential allergen by Allergenonline (http://www.allergenonline.com) or Allermatch (http://allermatch.org; Fiers et al. ), two tools that meet Food and Agriculture Organization/World Health Organization (FAO/WHO) Codex alimentarius guidelines for allergenicity assessment […]

library_books

Biofortification of rice with lysine using endogenous histones

2014
Plant Mol Biol
PMCID: 4302240
PMID: 25512028
DOI: 10.1007/s11103-014-0272-z

[…] We surveyed the GenBank database for rice proteins rich in lysine (>10 mol%) and carried out 8-mer, 80-mer, and full FASTA searches using the allergen databases AllergenOnline and Allermatch to the lysine-rich proteins’ sequence homology with known allergens according to the WHO/FAO guidelines for genetically modified food (FAO and WHO ). Two candidates, RLRH1 (NP_001054458) an […]

library_books

Allergenicity Assessment of Allium sativum Leaf Agglutinin, a Potential Candidate Protein for Developing Sap Sucking Insect Resistant Food Crops

2011
PLoS One
PMCID: 3218009
PMID: 22110739
DOI: 10.1371/journal.pone.0027716

[…] The Allermatch™ web tool was used to test the ASAL (Accession No. EU252577, amino acid sequence: MARNLLTNGEGLYAGQSLDVEQYKFIMQDDCNLVLYEYSTPIWASNTGVTGKNGCRAVMQRDGNFVVYDVNGRPVWASNSVRGNGNYILVLQKDRNVVIYGSDIWS […]

library_books

Identification of B Cell Epitopes of Alcohol Dehydrogenase Allergen of Curvularia lunata

2011
PLoS One
PMCID: 3102081
PMID: 21647452
DOI: 10.1371/journal.pone.0020020

[…] The allergenicity of CADH was predicted by a full FASTA alignment in the Structural Database of Allergenic Proteins (SDAP) and Allermatch allergen database. […]

library_books

An Allergen Portrait Gallery: Representative Structures and an Overview of IgE Binding Surfaces

2010
Bioinform Biol Insights
PMCID: 2964044
PMID: 20981266
DOI: 10.4137/BBI.S5737

[…] to implement the WHO/FAO criteria are widely available, and include the FARRP database (www.allergenonline.com), the Structural Database of Allergenic Proteins (SDAP; http://fermi.utmb.edu/SDAP/) and Allermatch (http://allermatch.org/), where a user can rapidly compare molecular features of individual or groups of known allergens, such as protein sequence, 3D structure, IgE epitopes and literature […]

library_books

Comparative genomics of fungal allergens and epitopes shows widespread distribution of closely related allergen and epitope orthologues

2006
BMC Genomics
PMCID: 1613252
PMID: 17029625
DOI: 10.1186/1471-2164-7-251

[…] A database of 82 non-redundant fungal allergen sequences was compiled from 102 fungal allergen protein sequences from databases at Allergome [], SDAP, Allermatch [] and SwissProt []. The non redundant list contained the following allergen sequences: Alt a 1, Alt a 3, Alt a 4, Alt a 5, Alt a 6, Alt a 7, Alt a 8, Alt a 10, Alt a 12, Cla h 2, Cla h 5, […]


Want to access the full list of citations?
Allermatch institution(s)
Applied Bioinformatics, Plant Research International, Wageningen University and Research Center, Wageningen, Netherlands; Institute of Food Safety, Wageningen University and Research Center, Wageningen, Netherlands

Allermatch reviews

star_border star_border star_border star_border star_border
star star star star star

Be the first to review Allermatch