Metazome statistics
Citations per year
Tool usage distribution map
Associated diseases
Popular tool citations
Related tools
Protocols
Metazome specifications
Information
| Unique identifier | OMICS_21286 |
|---|---|
| Name | Metazome |
| Restrictions to use | None |
| Community driven | No |
| Data access | File download, Browse |
| User data submission | Not allowed |
| Version | 3.2 |
| Maintained | Yes |
Taxon
-
Invertebrates
- Bombyx mori
- Caenorhabditis elegans
- Drosophila melanogaster
-
Primates
- Homo sapiens
-
Rodents
- Mus musculus
- Rattus norvegicus
-
Vertebrates
- Danio rerio
- Gallus gallus
- Xenopus tropicalis
Maintainer
- person_outline Metazome Team
Additional information
Metazome citations
(21)An evaluation of the evolution of the gene structure of dystroglycan
[…] All the gene sequences investigated were retrieved either from the Ensembl database [] or from the Metazome v3.0 database from the University of California (http://www.metazome.net). Searches were completed as of the end of January 2016. Searches with protein sequences were performed by BLASTP at N […]
The evolution of genes encoding for green fluorescent proteins: insights from cephalochordates (amphioxus)
[…] a), the sea snail limpet Lottia gigantea (Mollusca) and the acorn worm Saccoglossus kowalevskii (Hemichordata) from EnsemblMetazoa (http://metazoa.ensembl.org) (for S. purpuratus and L. gigantea) and Metazome v3.0 (www.metazome.net) (for S. kowalevskii). GFP-encoding gene was screened by hmmsearch (option: -E 1e-4) for these proteomes. […]
Tentacle Transcriptome and Venom Proteome of the Pacific Sea Nettle, Chrysaora fuscescens (Cnidaria: Scyphozoa)
[…] 1 October, 2013); (b) Cnidarian protein sequences from the GenBank non-redundant (nr) protein database; (c) the complete genomes and transcriptomic data sets of H. vulgaris and N. vectensis from the Metazome project []; and (d) the UniProt animal toxin and venom database [,]. The transcriptome was functionally annotated using InterProScan (version 5) [] and Blast2GO (version 2.5) []. Proteins wer […]
Reassessing ecdysteroidogenic cells from the cell membrane receptors’ perspective
[…] data from PGs of day 4, 5th instar B. mori larva in an attempt to identify additional proteins not identified by our method. Comparisons with that dataset were generated using the BLASTP algorithm on Metazome v3.0 (http://www.metazome.net/search.php?show=blast&method=Org_Bmori) and are reported on . […]
Calcareous sponge genomes reveal complex evolution of α carbonic anhydrases and two key biomineralization enzymes
[…] axa were obtained from GenBank [] or identified by BLAST searches against data from sequenced invertebrate genomes [,-] and transcriptomes [] from data of publicly available sources: Compagen [,] and Metazome v3.0 [] (Additional file ). In Hydra, we excluded some proteins, which had additional domains and only partial CA-domains. Sequences were aligned with MAFFT version 7 [] and sites for phyloge […]
The Early Expansion and Evolutionary Dynamics of POU Class Genes
[…] RIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWL. Sequences from Hydra, Nematostella, Lottia, Caenorhabditis, Tribolium, Drosophila, Strongylocentrotus, Xenopus, Mus, and Homo were collected from Metazome (http://www.metazome.net/, last accessed August 24, 2014) using BLASTP against the predicted proteomes. For A. queenslandica, we used TBLASTN against the Spongezome Metazome database (http:// […]
Metazome reviews
Be the first to review Metazome