TatP protocols

View TatP computational protocol

TatP statistics

To access cutting-edge analytics on consensus tools, life science contexts and associated fields, you will need to subscribe to our premium service.

Subscribe
info

Citations per year

Citations chart
info

Popular tool citations

chevron_left Secretome analysis chevron_right
Popular tools chart
info

Tool usage distribution map

Tool usage distribution map
info

Associated diseases

Associated diseases

TatP specifications

Information


Unique identifier OMICS_03899
Name TatP
Interface Web user interface
Restrictions to use None
Computer skills Basic
Stability Stable
Maintained Yes

Maintainer


  • person_outline Henrik Nielsen <>

Publication for TatP

TatP in pipelines

 (2)
2013
PMCID: 3906813
PMID: 24030600
DOI: 10.1038/ismej.2013.152

[…] for each data set. the confidence of each node was determined by assembling a consensus tree of 100 bootstrap replicates. the presence of tat signal sequences on psra proteins was predicted using tatp 1.0 (), available at: http://www.cbs.dtu.dk/services/tatp/., this study was conducted along the line p transect of the nesap (), beginning in si, vancouver island, british columbia (si, station […]

2007
PMCID: 2040162
PMID: 17825110
DOI: 10.1186/1471-2105-8-330

[…] pp. the proteins translocated by twin-arginine translocase bear a unique twin-arginine motif [], the presence of which is a useful feature for distinguishing between pp and non-pp proteins. we use tatp 1.0 [], a neural network-based method, to predict the presence of twin-arginine translocase motifs., 4. transmembrane β-barrels (tmb): a large number of proteins residing in the om […]


To access a full list of citations, you will need to upgrade to our premium service.

TatP in publications

 (52)
PMCID: 5911502
PMID: 29713316
DOI: 10.3389/fmicb.2018.00738

[…] protein specificity was predicted by tcdb (). signalp and secretomep were used to predict signal peptides and secreted proteins, respectively (; ). to predict the twin-arginine motif we utilized tatp server (). autotransporter proteins were predicted by search for pfam domains pf03797, pf12951, pf05662, pf05658, pf11924, pf11557, pf16168, pf15403, pf03895 with hmmer package. to find […]

PMCID: 5875014
PMID: 29598818
DOI: 10.1186/s12934-018-0901-3

[…] classified as putative signal peptides, whereby sequences possessing a d-score above 0.7 having a high probability that they in fact really do so []., for the identification of tat signal peptides, tatp (http://www.cbs.dtu.dk/services/tatp/ []), tatfind (http://signalfind.org/tatfind.html []), and pred-tat (http://www.compgen.org/tools/pred-tat/ []) are commonly used prediction programs. […]

PMCID: 5924526
PMID: 29597294
DOI: 10.3390/genes9040184

[…] genes in the genome of h. elongata dsm 2581t []. the copper resistance protein pcoa (helo_1864) made a promising candidate with congruent identification of a tat leader peptide by pred-tat [] and tatp1.0 []: msmpqkpllpltrrqllkggsalgistmalglppawa-spwg (twin-arginin motif and cleavage site underlined). already well investigated is the periplasmatic ectoine binding protein teaa (helo_4274) […]

PMCID: 5952966
PMID: 29608732
DOI: 10.1093/gbe/evy049

[…] in addition, signal peptides were predicted by phobius (, ), which, in contrast to signalp, returns discrete predictions rather than scores., as we focus on sec-mediated protein secretion, we used tatp () to remove cogs containing proteins utilizing the twin-arginine translocation (tat) pathway., results of these three methods were combined to derive a consensus prediction with four possible […]

PMCID: 5700972
PMID: 29170530
DOI: 10.1038/s41598-017-16325-1

[…] to ncbi; b – according to kegg; c – according to uniprotkb-ec and interpro; d – according to smart; e – according to pfam; f – according to island viewer; g – according to signalp, phobius, and tatp–; h – according to stitch 4.0. “+” – plus strand; “−” – minus strand; mf – molecular function; bp – biological process; sp – signal peptide; y – yes; n – no; pi – pathogenicity island. , a – […]


To access a full list of publications, you will need to upgrade to our premium service.

TatP institution(s)
Center for Biological Sequence Analysis, BioCentrum-DTU, Technical University of Denmark, Lyngby, Denmark

TatP reviews

star_border star_border star_border star_border star_border
star star star star star

Be the first to review TatP