TatP statistics

Tool stats & trends

Looking to identify usage trends or leading experts?

Protocols

TatP specifications

Information


Unique identifier OMICS_03899
Name TatP
Interface Web user interface
Restrictions to use None
Computer skills Basic
Stability Stable
Maintained Yes

Maintainer


  • person_outline Henrik Nielsen

Publication for TatP

TatP citations

 (83)
library_books

Comparative Genomic Analysis of Holospora spp., Intranuclear Symbionts of Paramecia

2018
Front Microbiol
PMCID: 5911502
PMID: 29713316
DOI: 10.3389/fmicb.2018.00738

[…] rter protein specificity was predicted by TCDB (). SignalP and SecretomeP were used to predict signal peptides and secreted proteins, respectively (; ). To predict the twin-arginine motif we utilized TatP server (). Autotransporter proteins were predicted by search for PFAM domains PF03797, PF12951, PF05662, PF05658, PF11924, PF11557, PF16168, PF15403, PF03895 with HMMer package. To find phage-lik […]

library_books

Signal peptides for recombinant protein secretion in bacterial expression systems

2018
Microb Cell Fact
PMCID: 5875014
PMID: 29598818
DOI: 10.1186/s12934-018-0901-3

[…] are classified as putative signal peptides, whereby sequences possessing a D-score above 0.7 having a high probability that they in fact really do so [].For the identification of Tat signal peptides, TatP (http://www.cbs.dtu.dk/services/TatP/ []), TatFind (http://signalfind.org/tatfind.html []), and PRED-Tat (http://www.compgen.org/tools/PRED-TAT/ []) are commonly used prediction programs. However […]

library_books

Engineering the Salt Inducible Ectoine Promoter Region of Halomonas elongata for Protein Expression in a Unique Stabilizing Environment

2018
Genes
PMCID: 5924526
PMID: 29597294
DOI: 10.3390/genes9040184

[…] sec genes in the genome of H. elongata DSM 2581T []. The Copper resistance protein PcoA (HELO_1864) made a promising candidate with congruent identification of a Tat leader peptide by PRED-TAT [] and TatP1.0 []: MSMPQKPLLPLTRRQLLKGGSALGISTMALGLPPAWA-SPWG (twin-arginin motif and cleavage site underlined). Already well investigated is the periplasmatic ectoine binding protein TeaA (HELO_4274) as par […]

library_books

Evolutionary Interplay between Symbiotic Relationships and Patterns of Signal Peptide Gain and Loss

2018
Genome Biol Evol
PMCID: 5952966
PMID: 29608732
DOI: 10.1093/gbe/evy049

[…] ales genomes derived from the OMA orthology database, 52,902 (8.4%) were identified as containing reliable signal peptides based on the intersection of positive SignalP, positive Phobius and negative TatP predictions, respectively, whereas 518,174 (82.7%) proteins were determined to be reliable negatives. The remaining 55,604 (8.9%) cases consist of 52,050 (8.3%) discordant predictions (51,787 pre […]

library_books

Conformational determinants necessary for secretion of Paecilomyces thermophila β 1,4 xylosidase that lacks a signal peptide

2018
PMCID: 5783984
PMID: 29368263
DOI: 10.1186/s13568-018-0542-2

[…] As previously reported, assessment by TatP 1.0 (Bendtsen et al. ) and SignalP 4.0 (Petersen et al. ) indicated that PtXyl43 (also named as X12345 herein) does not encode a twin-arginine signal peptide or non-twin-arginine signal peptide f […]

library_books

A Single Dual Function Enzyme Controls the Production of Inflammatory NOD Agonist Peptidoglycan Fragments by Neisseria gonorrhoeae

2017
MBio
PMCID: 5646250
PMID: 29042497
DOI: 10.1128/mBio.01464-17

[…] l material). Included in this N-terminal extension is the sequence SRRXXL, which indicates a twin-arginine-translocase (TAT)-dependent signal peptide. Analysis of the N-terminal end of LdcA using the TatP 1.0 server predicts a TAT-dependent signal peptide and a potential cleavage site between residues 29 and 30 (). No Sec-dependent signal peptide is predicted by SignalP 4.1 ().To determine where L […]

Citations

Looking to check out a full list of citations?

TatP institution(s)
Center for Biological Sequence Analysis, BioCentrum-DTU, Technical University of Denmark, Lyngby, Denmark

TatP reviews

star_border star_border star_border star_border star_border
star star star star star

Be the first to review TatP